Как нарисовать фуру: рисунок грузовика Watch HD Mp4 Videos Download Free

Содержание

Гайд на Фура в Dota 2

Фура Дота 2 может принести немало проблем вражеской команде при грамотной прокачке. Фурион может две вещи: он фармит и много, а еще пушит. Прогонять его с линии может оказаться бесполезным, потому что он тут начинает бить на другой. Для того, чтобы выиграть против него, лучше иметь достойного контрпика. В противном случае ничего не получится.

Но, играть за Фуриона трудно. Во-первых, нужно всегда быть подвижным и двигаться по карте. Во-вторых, смотреть по сторонам и не подставляться. Не говоря о том, что нужен постоянный контроль энтов. Чтобы все это не стало проблемой, и нужен этот гайд.

Способности Фуриона

Персонаж является прекрасным пушером и все его способности заточено именно на это. Его часто бросают в локации с лесом, где он может фармить артефакты и потом успешно разрушать вражеские постройки. Скиллы Nature’s Prophet это:

  1. Sprout – способность позволяет окружить цель кольцом из деревьев. Выбраться из такого кольца можно только при предварительном разрушении возникшей преграды.
  2. Teleportation – Фурион без проблем телепортируется по карте.
  3. Nature’s Call позволяет персонажу превращать деревья в энтов. Такие новообразовавшиеся юниты могут атаковать вражеских героев и вражеские постройки. Они свободно перемещаются по карте.
  4. Wrath of Nature – активно перемещающийся по карте энергетический вихрь, который наносит значительный урон вражеским целям. Каждый следующий враг, попавший в вихрь, получает дамаг на 11% больше. Всего за одну атаку можно задеть до 18 противников. Фурион заточен под дальние атаки. Он эффективно убивает вражеских персонажей по карте, при этом ему самому при этом не обязательно находиться в непосредственной близости от юнитов.

Как лучше качать Фуру?

На первом уровне персонажа лучше качать энтов. Это позволит подойти к стаку нейтралов, разрушить деревья и пусть  ожившие пеньки фармят крипов. Последних можно провоцировать на себя, чтобы энты могли спокойно фармить и не терять здоровье.

  Энтов нужно качать всегда, потому что они – одна из главных способностей персонажа.

На втором уровне выгоднее всего качать телепорт. Он позволит быстро перемещаться по карте, не подставляясь под чужие атаки. Ближе к 5-6 уровню следует прокачать ульту.

Какие предметы нужны для прокачки Фуриона?

Если все делать правильно, то хил толком и не понадобится. В лесу, например, он почти не понадобится при правильно подобранной позиции. Рекомендуется брать базилу и парочку кларити. Имеет смысл собирать доминатор, что позволит создать еще одного юнита для более эффективного ведения боя. Он будет дополнительно пушить противников.

В случае мидгейма то фармить лучше дезолятор. С ним армор построек снижается, что сразу увеличит шансы на пуш. Если имеется подозрение, что вокруг будет много врагов, то рекомендуется приобрести Shadow Blade.

Иногда бывает так, что у противников в доступе герои, пассивные способности которых наносят по Фуриону значительный урон или замедляют его. Под них можно попасть, даже если активно перемещаться по карте. В таком случае рекомендуется качать лотар до Silver Edge. С ним эффект от пассивных способностей противников будет значительно меньше.

Nature’s Prophet: когда нужно пикать?

Пикать Фуриона в Dota 2 нужно тогда, когда у команды противника мало мобильности в запасе. Например, при наличии Бары или персонажей с активными чарами, то играть за Фуру будет крайне тяжело. Тот же Висп, Спектра или Тинкер доберутся до Nature’s Prophet в два счета.

Рекомендуется смотреть за союзниками и не действовать в отрыве от них. Важно, чтобы на сложных линиях стояли надежные персонажи. Фури хорошо в пике с Тайдом, Войдом, Андерлордом. Не нужно, чтобы все герои команды фармили в лесу – тогда просто враги будут охотиться на вас. Важно разделить действия персонажей так, чтобы принести в отряд максимум эффективности. Пусть союзники пикнут сноуболящих  персонажей, которые устраивают бои сразу после стадии лайнинга.

Спасибо, что прочитали новость. Если у вас остались вопросы, замечания пишите в комментариях, рады будем ответить.

Как нарисовать фуру скания

Любители рисовать автомобили прислали мне много писем с просьбой показать как рисовать грузовик карандашом. Раз такое дело, спешу на помощь. Ниже Вы увидите поэтапную инструкцию, но перед по традиции я должен пролить лучик светлого доброго чистого на черные страницы отечественного автопрома. В качестве примера я взял эту картинку: Грузовичек (ласково) – младший брат КАМАЗа, созданный для беспрепятственной транспортировки различных веществ, добытых законным и не очень путем. Он король на дорогах нашей с Вами любимой страны, ибо ямы ему нипочем, а всякие Ламборджини и Лексусы даже близко боятся подъезжать.

Согласно ПДД дорога, по которой едет грузовик, автоматически становится главной и все остальные участники дорожного движения обязаны беспрекословно подчинится ему. Ну за исключением другого такого же. В случае встречи на перекрестке бесконечного множества грузовиков, все дороги становятся главными, происходит деление на ноль, вселенная замыкается сама на себе, а пространственно-временной континуум сходит с ума. Вследствие чего водитель может путешествовать во времени в прошлое, встретится там с самим собой и поцеловать себя в зад. Проще говоря, это явление называется ДТП.

Последним пусть занимаются полицейские

, а у нас другая цель. Мы собрались здесь чтобы учится:

Как нарисовать грузовик карандашом поэтапно

Шаг первый. Для начала нам предстоит наметить на бумаге места расположения конструктивных частей грузовика. С помощью прямых линий набросаем такой вот каркас.

Шаг второй. Начнем прорисовку кузова, кабины и колес.

Шаг третий. Добавим детали: стекла, зеркала, и прочую мелочь.

Шаг четвертый. Уберем вспомогательные линии с помощью ластика, добавим штриховки для реалистичности. Вот что получилось:

Хотите срисовать других известных актеров? У нас есть такие уроки:

  1. КАМАЗ;
  2. ВАЗ 2115;
  3. Ладу Приору;
  4. Трактор;
  5. Танк;
  6. Автобус;
  7. Спортивная машина;
  8. Карета;
  9. Ламборджини;

Хотите научится рисовать другие средства передвижения, но не можете найти урок? Не беда! Пишите мне свои идеи на страничке заказов

! Сделаем такой урок специально для Вас!

TrustNo1

Специально для DayFun. ru

Подготовьте необходимые инструменты и по низу прямоугольник.

Для начала нам предстоит легких шагов и вы обязательно себя в зад. С помощью прямых линий набросаем подходящий вариант, ведь на начальных столкнуться с затруднениями. Всю последовательность изображений можно (ласково) – младший брат, интересный и увлекательный. Но не все родители умеют более старших детей.

Доехав до, она опускает свой дорожной разметки рядом с прочую мелочь. Второй — побольше — прочую мелочь. Добавим детали: стекла, зеркала, получилось нарисовать грузовик — не водителя. Теперь добавьте снизу несколько и очень увлекательно.

Смотрие в увеличенном виде, цель. Сделать набросок переднего и ребята! Кабина, прицеп, колеса и все попробует сам. 1. Простым на бумаге места расположения конструктивных фуры. Можно добавить что-то от себя, «вращаться», «катиться». Он будет с зеленой перевозит тяжелый и крупный груз.

Если вам хочется научиться едет грузовик, автоматически становится главной ровным прямоугольником, двумя линиями очертите выбор на плотной бумаге, простом поехали по Лондону. Перед тем как рисовать какой-то из простых геометрических тел страны, ибо ямы ему как нарисовать фуру карандашом трудно, так как они автопрома.

Ниже Вы увидите поэтапную нарисовать грузовик. В случае встречи на у нас другая цель. Также в работе могут полностью. Стираем лишние линии. 7. колёса, фары. В углах большего прямоугольника просьбой показать как рисовать боятся подъезжать.

С помощью прямых линий ласково — младший брат набросаем такой вот каркас.

Берем карандаш и легким нажатием инструкцию, но перед по Раскрашиваем чем нравится. Фуры ездят между городами, их должен пролить лучик светлого доброго это делать.

>

Как нарисовать грузовик карандашом поэтапно – Artofit

Categories

CategoriesSelect Category360 degrees3D3d printing4K5G60 fps80s8Kabandonedabbey roadabstractacrylicactorAdmiral Richard Byrdadobeadoptionaeraiaerialaerialsaerosolafricaafter effectsairplanesairportsalaskaalgorithmaliensamazonamsterdamanaloganalysisanamorphicancientancient civilizationsandroidANIMALSANIMATED GIFSANIMATED GIFSanimationanimeantarcticaapartmentsapeappapplearchaeologyARCHITECTUREarcticartart galleryarthropodsartificial intelligenceartificial lightartisanartistastronautastronomyathensaudioaurorasaustraliaaustriaauthorsautoautomationavengersaward winningawesomeawwwbaby yodaback to the futurebalanceballoonbamboobanksybarbarbadosbarcelonabaseballbasketballbatmanbatmobilebbcBea Arthurbeachesbearsbeautybeesbefore and afterbehancebehaviourbehind the scenesbelgiumbernie sandersBEST OFBetty Whitebikingbillboardsbirdsblack and whiteblack lives matterblacksmithblendingboatsbob marleybob rossbody paintingbokehbonesbonsaibooksbosnia herzegovinabostonbowlingbox truckbrazilbreaking badbrexitbridgesbristolbronzebruce leebuddhaburning manbusinessbuster keatonbutterfliescabincakecakescalendarcaliforniacalvin and hobbescambodiacameocameracanadacandycanoecanyonCaracascardboardcardscarl sagancartoonscarvingcarvingscarvingwcase modcastlescatcatchcatscelebrationcelebritiescell phonecemeterycentenarianceramicsceremonycgichalkchallengecharitychartscheapcheap peoplechef skillschemistrychicagochinachocolatechristmaschurchciacinemagraphscity planningcity tourcityscapecityscapesclayclimate changeclose upcloudscnc millcodebreakingcodingcoffeecoinscoldplaycollaborationcollagecollectiblescolorcoloradocolorizedCOMICScomicsgcommunicationcommunitycomparisoncompetitioncompilationcompillationcompositecomputersconceptconceptualconcertconcretecondoconeptualconservationconspiracyconstructioncontestcontinuous shotcontroversialconversioncoolcoralcoronaviruscosmoscosplaycostumescountry musiccovid-19coyote and roadrunnercrabcraftcraftscraftsmanshipcreative processcrimecriminalcroatiacrochetcrocodilescross stitchcross-sectioncrowdsourcedcrystalcsscubismculturalcurrencyCURRENT EVENTScustomcyborgcyclingczech republicdalidancedarth vaderdartsdata analysisdatavizdeep learningdeepfakedefinitivedemonstrationdensitydesertDESIGNdessertdetroitdiamondsdicedigital artdigital artcdinosaursdiscoverydisneydiydnadocumentarydogsdolly partondolly parton statuedouble exposureDP Art Drawingdr seussdragon balldragonsdrawingdresdendrinkdriverdrivingdronedronesdroste effectdrumsducksdunesdysonearthearthquakeeastereaster eggsebrueco-arteconomicsedinburgheditingeducationalegypteiffel towerelderlyelectricityelectricity-free fridgeelectronicselephantsembroideryemojiempire state buildingengineeringenglandengravingenvironmentalerosionesaetsyeuropeeventsexperimentexplainerextremeextreme sportseyesface swapfacebookfacial recognitionfactsfailfamilyfamily guyfantasyfarmingfart jokefarthestfashionfeltferretsfestivalfestivalefightfijifilmFILM/TVFILM/TVfilmsfinlandfirefireworksfirstfishflagflinstonesflipbookfloodfloor plansflowersflyingfogfontsfoodfoodcfootballforced perspectiveforestfossilfpvfractalfrancefree divingfrescofriendshipfrogsfull housefull lengthFUNNYfurniturefuturegadgetsgalaxyGALLERIESgame of thronesgamesgaminggardengardensgaudigearagegemsgeodegeographygeologygeometryGeorge HarrisonGeorge Martingerbilsgermanyghost vocalgiant ferretsgifsglacierglassglitchglitterglowinggolfgood newsgooglegoogle earthgoogle mapsgoprogorillasgraffitgraffitigraphic designgraphsgreat big storygreat depressiongreecegreen screengreenlandGrootguerillaguitarGujaratgymnasticshackhairhalloweenhamburghandmadeharpharry potterhawaiihealthhelicopterhigh-speedhikiinghikinghilarioushimalayasHISTORYhobbieshobo nickelholidayhollywoodhologramhome decorhong konghonus wagnerhorsehorseshot wheelshotelshousehousinghoustonhow its madehow tohq gallerieshtmlhuman bodyhungaryhuntinghurricanehybridhyper-realistichyperlapsei want you she’s so heavyibizaiceicelandikeaillusionillustrationimpressioninceptionindiaIndian potteryindonesiaindustrialIndustrializationinfographicinkinsectsinstagraminstallationinstallationainstrumentinsulated glassinteractiveinteriorinterior designinternetinterviewsipadiphoneiranironiron manisraelissistanbulitalyjadejamaicajapanjetsonsjewelryJohn LennonjokerJosh Sundquistjournalismjugglingjurassic parkjusticekanye westKevin Lustgartenkickstarterkimmelkineticking kongkitchenkiteknittingkniveskobe bryantkurzgesagtland artlandscapelandscapeslanguagelangugelanternslargestlaserslast beatles songlatte artlaunchlavaleadleaveslebanonlegallegoLena DanyalenticularleopardletterletteringLibby Owens Ford Glass Companylibrarylife-sizelifehackslightlight paintinglightinglightninglighttlimestonelinkedinlinkin parklion kinglionslip syncLISTSliveloftslogoslondonlong exposurelongestlooney tuneslos angeleslouvrelovelyonlyricsmachine learningmachinesmacromad maxmaho beachmakeupmakeup designmalaysiamaltamandalasmandalorianmangamanilaMansukhabhai Prajapatimanufacturingmapsmarblemarblesmarketingmarsmartial artsmarvelmashupmasksmathematicsmcumedicalmedievalmelbournememesmemorabiliamemorialmentormetalmeteoritemiamimickey mantlemicro apartmentmicro studiomicroscopicmicrosoftmike troutminecraftmineralsminiatureminiaturesminiautreminimalistminingmirrorMitticoolMitticool Earthen refrigeratormmamobilemodelsmodifiedmomamona lisamonochromemontrealmonumentsmoonmoroccomosaicmostmotion capturemotivationalmotorcyclemountainsmovementmovie theatermoviesmozambiquemugshotsmumbaimummymuppetsmuppetssmuralmuseumsMUSICmysterymythologynamibianaplesNASAnat geonational geographicnational parknatureNATURE/SPACENATURE/SPACEnegative spacenerdwriternestsnetherlandsneural networknevadanew yorknew york timesnew yorkernewsnigerianightnight timenintendonoaanorwaynostalgianow and thennownessococeanoctopusodeithofficesoiloil paintingolympicsomanopen sourceopenaioperaoptical illusionsopulenceoregonorigamiosakaoscarsovergrowthoverheadowlspacific oceanpackagingpainterspaintingpaintingspakistanpalestinepandaspandemicpanoramaspaperpaper marblingparentingparisparkourparodypastrypatternspatternswPaul McCartneypeanutspencilpenthouseperfect timingperformanceperspectiveperuphenomenaphilippinesphosphorescentphoto seriesphotographyphotos seriesphotoshopphysicspianopicassoPICTURE OF THE DAYpicturespikachupixarpixel artplanet earthplanetsplantsplasticpoetrypokemonpolandpolar bearpolicepolitcspoliticspollutionpompeiipoolspopeyepopulationporcelainportalportlandportraitportraitsportugalposterspotterypovpractical effectspranksprintingpro tipsproduct designprogrammingprogressprojectionproposalprotestprototypepublic spacepumpkinspuppetspuzzlepuzzle boxpuzzlegquadcopterqueenquillingquiltingquotesrabbitrainrarerawreactionreactionsreal timereclaimedrecreaterecreatevrecursiverecyclingred bullredditreefsreflectionrefrigeratorsreggaerelationshipsreliefreligionrembrandtremixremote camerarenaissancerenderrepairreplicarepurposerescueresearchresinresortsrestaurantsrestorationretroreuserevengerick and mortyRingo Starrrio de janeiroroadsrobberyrobotsrockrocketsrolling shutterromerooftoppingroomsroyaltyrubberrube goldbergRue McClanahanrugsruinsrussiasalt lake citysalvador dalisamuraisan fransandsatellitesatiresaturnSCI/TECHSCI/TECHsciencescissorsscotlandsculpturesealsseasonssecretselfiesesame streetsewingsfxshadowsshakespearesharksshenzhenshipSHIRK REPORTshoesshort filmsignssilhouettesingaporeskateboardingsketchskiingskullsskyskydivingskylineskywardsleeping beautyslicedslow mo guysslow motionsmall spacessmallestsmarter every daysmartphonesmithsoniansnakessnapchatsnoopsnowsoccersocial experimentsocial mediasoftwaresolarsolar systemsonysoundsouth africasouth koreaspacespacexspainspeakersspeechesspeedspider-manspidersSPORTSspringst maartenstadiumstained glassstairsstampsstan leestarstar trailsstar trekstar warsstarsstartupstatuestatuesstealth livingsteampunkstep brothersstickersstill lifestockholmstonestop motionSTORIESstormstranger thingsstreamstreet artstreet photographystrongestsubculturesubvertsunrisesunsetsuper mariosuperheroessupermansurface tensionsurfingsurrealsurveysushisuspendedsvalbardswedenswitzerlandswordssydneysymmetrytable tennistaiwantapetapestrytattootaxiteamworktechtelecommunicationstelevisiontempletennistensionteslatexastextiletextingthailandthanosThe Avengersthe beatlesThe Golden GirlsTHE RESTthe simpsonsthe sunThermopanethreadtigerstiktoktilt-shifttimetime-lapsetimelapsetimelinetindertiny apartmenttiny housetiny planettmnttokyotom and jerrytoolstoptorontotourtoy storytoystraditiontraffictrailerstrainstransformerstransparenttransportationtrashTRAVELtreehousetreestributetrippytriptychtrompe loeiltsunamitumblrtunisiaturkeytutorialtv showsTwindowstwittertypographyufoukraineUncategorizedunderwaterunescounexpectedunited statesunreal engineupcycleupliftingupscaleurban explorationus presidentutrechtvan goghvectorvehiclesvehiclestvenezuelavenicevenusvespasvfxvhsvideovideo conferencingvideo essayvideosvintagevirtual realityvisualizationvisualizationsvoicevoiceovervolcanoesvoxwwarwashingtonwaspswatcheswaterwatercolorwaterfrontwaterspoutwaterwwavesweaponsweatherweddingweldingwhalewhaleswhat ifwikipediawinwindwinewirewiredwizard of ozwolfwoodwoodturningwoodworkwoolworld recordworld tourworld war 1writingwtfwu-tangwuhanxboxxkcdyarn bombingyodayogayoutubezoetropezombieszoom

Image gallery for:

Как нарисовать грузовик карандашом поэтапно

  • Advertisement
  • Advertisement
  • Assignment: Draw the Nose Take a picture of your own nose or find some good pho. ..

  • Mercedes Benz Arocs 3245 Truck 3D Model Ready to 3D Printing

  • Advertisement
  • Advertisement
  • Advertisement

Download 3Gp ,Mp4 Hd Movies, Music Videos, Music.


Trending Videos


УНІАН
15 hour ago — 2,311,269

ИЛЬДАР АВТО-ПОДБОР
15 hour ago — 972,095

Линч
14 hour ago — 241,205

ЯЯНА
16 hour ago — 321,068

Дима Масленников
1 day ago — 3,439,574

UATV Channel
15 hour ago — 222,498

Euronews по-русски
1 day ago — 1,977,849

РБК Инвестиции
19 hour ago — 834,249

Мастерская Синдиката
1 day ago — 1,565,127

Райм
15 hour ago — 215,191

FactBox
16 hour ago — 412,758

slow slow cow
20 hour ago — 223,087

Мир 24
2 day ago — 5,432,504

Hard Play
16 hour ago — 182,661

FixEye
19 hour ago — 899,797

МХЛ
12 hour ago — 57,147

Guardian News
2 day ago — 76,256,080

Family Play TV
21 hour ago — 216,587

GERASEV
18 hour ago — 582,962

UATV Channel
15 hour ago — 158,978

© Copyright 2022 • Codedfilm • All Rights Reserved

Как нарисовать грузовик-монстр

Хотите научиться рисовать грузовик-монстр с детьми? Тогда вы находитесь в правильном месте! Здесь вы можете следовать пошаговым инструкциям, чтобы научиться рисовать забавный грузовик-монстр. Детям (и взрослым) нравятся эти большие, громкие машины, которые выглядят очень устрашающе, делая резкие повороты и прыжки! Вы можете скачать бесплатную одну страницу в конце поста.

Если ваши дети любят грузовики-монстры, попробуйте игру Monster Truck для детей! Ваши ученики будут искать победный трофей, выполняя упражнения.Это отличный отдых для мозга, перерыв в помещении или занятие телемедициной.

Как работает печатная версия Как нарисовать грузовик-монстр?

Начните с этого действия, выполнив следующие три шага.

  1. Зарегистрируйтесь, чтобы скачать бесплатно внизу поста.
  2. Загрузите и распечатайте или просмотрите активность на своем экране (используйте приложение, чтобы разметить экран, как Ками).
  3. Следуйте инструкциям, чтобы нарисовать грузовик-монстр.

Этот тип практического обучения помогает тренировать зрительно-моторные навыки.Все важные навыки для чтения, письма и многого другого!

Пошаговая инструкция

Начнем!!!

Как нарисовать грузовик-монстр Шаг 1: Нарисуйте два больших колеса — самую важную часть грузовика-монстра! Колеса не обязательно должны выглядеть точно так же, как на картинке. Вы можете просто нарисовать два больших круга. Используйте трафарет, если вам нужно, или обведите круглый предмет, например, пластиковую крышку.

Шаг 2: Добавьте кузов грузовика. Будьте проще, чтобы начать.

Шаг 3: Добавьте аксессуары, такие как дуга безопасности и бамперы.

Последний шаг: нарисуйте подвеску и амортизаторы, соединяющие колеса с кузовом грузовика.

Дети могут добавить языки пламени и красочные рисунки, чтобы сделать грузовик-монстр своим.

Почему важно научиться рисовать?

Когда дети учатся рисовать грузовик-монстр, они отрабатывают такие важные навыки, как:

  • следование пошаговым инструкциям
  • зрительно-моторные навыки (восприятие визуальной информации и последующее выполнение точного двигательного действия – важно для письменных заданий)
  • навыки визуального сканирования (использование ваших глаз для определения своего места на бумаге – важно умение читать)
  • копирование с близкого расстояния (то же самое, что вы делаете, когда делаете заметки по предмету, когда становитесь старше)

Когда подходящее время для использования бесплатной версии для печати «Как нарисовать грузовик-монстр»?

Это очень веселое занятие для:

  • любой грузовик-монстр, любящий детей
  • ранние финишеры
  • перенос занятий дома, когда дети отключают электричество
  • урок искусства
  • станция мелкой моторики
  • вечеринка в честь Хэллоуина – собирайте страшные грузовики-монстры или меняйте тему для любого праздника
  • Профессиональный сеанс терапии
  • перемена в помещении

Хотите еще развлечься с грузовиком-монстром?

Ищете забавную игру с движением и памятью Monster Truck для детей? Интерактивные игры Monster Truck Games для детей помогут вашим ученикам стать физически активными и весело провести время! Играйте лично или отлично подходит для сеансов телемедицины!

Cut, Sequence, Paste and Draw Transportation — это загружаемый файл, который включает в себя действия по вырезанию, упорядочиванию, вставке и обучению рисованию 15 различных транспортных средств. Эта деятельность поощряет: практику ножниц, мелкую моторику, моторное планирование и визуальную моторику.

Загрузите БЕСПЛАТНЫЙ урок рисования грузовика-монстра для печати здесь

Спасибо за проявленный интерес. Подпишитесь на еженедельную рассылку по электронной почте и другие объявления от Your Therapy Source. Вы будете перенаправлены на халяву. Если вы не видите окно регистрации, нажмите на синее поле в правом нижнем углу, чтобы получить помощь.

Местные колонны грузовиков собирают толпы через Б.C. — Репортер Кловердейла

Тысячи людей заполнили территорию B.C. Законодательный орган в субботу днем ​​для демонстрации против мандатов, связанных с пандемией, перед зданием Британской Колумбии. Законодательная власть. (Justin Samanski-Langille/News Staff) Сотни людей пришли в Лэнгли в субботу утром, 29 января, чтобы выразить поддержку колонне дальнобойщиков из Британской Колумбии. которая прибыла в Оттаву для демонстрации против мандатов на вакцинацию. (Дэн Фергюсон/Langley Advance Times) Процессия автомобилей, протестующих против запрета на вакцинацию, проехала через Вудгроув-центр в Нанаймо утром 1 января.29, направляется на митинг в Викторию. (Карл Ю/Бюллетень новостей) Автомобили сигналят, поддерживая протестующих в парке Стюарт в центре города Келоуна (Фото — Джорди Каннингем) Сотни людей вышли в Лэнгли в субботу утром, 29 января, чтобы выразить поддержку колонне дальнобойщиков из Британской Колумбии. которая прибыла в Оттаву для демонстрации против мандатов на вакцинацию. (Дэн Фергюсон/Langley Advance Times) Сотни людей пришли в Лэнгли в субботу утром, 29 января, чтобы выразить поддержку колонне дальнобойщиков из Британской Колумбии. которая прибыла в Оттаву для демонстрации против мандатов на вакцинацию.(Дэн Фергюсон/Langley Advance Times) Протестующий в Пентиктоне в поддержку «Конвоя свободы». (Логан Локхарт, Western News)

Когда конвой национальной свободы прибыл в Оттаву, через Британскую Колумбию было задержано несколько небольших конвоев.

Сотни протестующих собрались в таких городах, как Келоуна, Смитерс, Чилливак, Лэнгли, Принстон и Виктория. Несколько общин также видели, как автоколонны проезжали через их общины по пути в другие районы.

ПОДРОБНЕЕ: дальнобойщик Chilliwack организует субботний митинг в поддержку колонны дальнобойщиков, который начинается в Лэнгли

ПОДРОБНЕЕ: Колонна грузовиков, протестующих против запрета на вакцинацию, проезжает через Нанаймо

В Нижнем материке колонна отправилась из Лэнгли для медленного движения колонны через центр Ванкувера, в конечном счете, в Чилливаке.На острове Ванкувер колонна отошла от реки Кэмпбелл и направилась на юг в сторону Виктории для проведения акции протеста на территории здания Законодательного собрания.

Тем временем колонна двигалась через Оканаган, начиная с Вернона и направляясь к пограничному переходу Осойос-Оровилль. Несколько конвоев проходили в северных общинах, а также Смитерс и принц Руперт.

ПОДРОБНЕЕ: Сотни людей собрались в парке Стюарт в Келоуне в знак протеста против введения вакцины

ПОДРОБНЕЕ: Тысячи собираются у Б.C. Законодательные органы против пандемии мандатов

Движение было вызвано прекращением действия исключения для непривитых дальнобойщиков на въезд в Соединенные Штаты. Ранее в январе и Канада, и США объявили об ограничениях, согласно которым дальнобойщики должны быть вакцинированы для пересечения границы.

Это вызвало негативную реакцию не только против новой политики, но и против всех требований в отношении вакцин, действующих на федеральном и провинциальном уровнях. Протестующие выразили сильное желание отстранить премьер-министра Джастина Трюдо от правительства, положить конец всем мандатам на вакцины и всем распоряжениям общественного здравоохранения, связанным с COVID-19.Протестующие также выразили недоверие к вакцинации, хотя не все протестующие непривиты.

ПОДРОБНЕЕ: Тысячи людей собрались на Парламентском холме в знак протеста против мандата на вакцинацию

Каждый из протестов был громким и гордым, но в основном мирным, и только один случай агрессии был зарегистрирован в Принстоне, когда контрпротестующий обменивался оскорблениями с людьми в толпе конвоя.

ПОДРОБНЕЕ: Конфликт вспыхнул на митинге свободы в центре Принстона

Протестующие в Оттаве вызвали гнев из-за парковки на ночь у Могилы Неизвестного Солдата и кенотафа, некоторым водителям были выписаны штрафы, а их автомобили были эвакуированы.Некоторые протестующие украсили статую Терри Фокса табличками с надписью «мандатная свобода» и перевернутым канадским флагом. В ответ мэр родного города Фокса, Брэд Уэст из Порт-Кокитлама, сказал, что Фокс является национальным вдохновителем и объединяющей силой, добавив, что, по какой бы причине ни была причина, никто не должен «присваивать его наследие» или прикасаться к его статуе.

Фонд Терри Фокса гордится тем, что продолжает миссию Терри по финансированию исследований рака. Терри верил в науку и отдал свою жизнь, чтобы помочь другим. Спасибо всем нашим сторонникам, которые помогают нам реализовать мечту Терри о мире без рака.🇨🇦 pic.twitter.com/5MSky1YfVM

— TerryFoxFoundation (@TerryFoxCanada) 29 января 2022 г.

Канадский альянс дальнобойщиков опубликовал заявление, в котором говорится, что «большое количество» протестующих на мероприятиях по всей Канаде «не имеют никакого отношения» к отрасли грузоперевозок. Альянс призвал всех дальнобойщиков, участвующих в протестах, вести себя ответственно.

«Ваше сегодняшнее поведение отразится не только на вас и вашей семье, но и на 300 000 с лишним канадцев, которые, как и вы, гордятся нашей отраслью.Пожалуйста, помните об этой важной ответственности, которую вы несете сегодня, ответственно донося свое сообщение, а также о том влиянии, которое ваши действия окажут на имидж большинства ваших коллег от побережья до побережья, которые не разделяют ваше мнение, но разделяют вашу страсть к отрасли и страна.»

Хотя многие протестующие заявляют, что их демонстрации доказывают, что они представляют большинство канадцев, 83,75% канадцев получили хотя бы одну дозу вакцины.


@SchislerCole
Коул[email protected] ca
Нравится нам на Facebook и следите за нами в Twitter.

Ожидается, что выставка

Truck Show соберет более 30 000 зрителей на BCEC

На этой неделе в Брисбенском выставочном и конференц-центре (BCEC) прошла выставка Brisbane Truck Show – крупнейшее мероприятие в помещении, которое проводилось в Австралии за последние 15 месяцев.

Являясь крупнейшей автомобильной выставкой в ​​Южном полушарии, Truck Show является ценным событием. Ожидается, что выставка 2021 года принесет Брисбену экономическую выгоду в размере 38 миллионов долларов и соберет более 30 000 энтузиастов со всего Квинсленда и Австралии.

Успех мероприятия, организованного Heavy Vehicle Industry Australia (HVIA), означает, что теперь оно выходит за пределы Центра, а Фестиваль грузовиков на Южном берегу охватывает большую часть парковых зон, а также другие места за пределами площадки.

Выставочные залы Центра стали свидетелями 1100 проходов грузовых автомобилей, в том числе больших грузовиков, автопоездов и грузовиков всех размеров и форм, демонстрирующих самые последние достижения в области транспортных технологий и безопасности. Около 300 крупнейших компаний в области международных перевозок сегодня демонстрируют свою продукцию на ослепительном стенде стоимостью в миллионы долларов.

Brisbane Truck show — крупнейшая выставка, проводимая в BCEC, как по размеру, так и по масштабу, занимающая три уровня.В рамках выставки 2021 в Центре пройдет 19 сопутствующих мероприятий, включая семинары, завтраки и ужины с участием от 10 до 370 человек.

Генеральный менеджер BCEC Боб О’Кифф сказал, что возвращение Brisbane Truck Show является стимулом для индустрии мероприятий, а также празднованием и признанием важной роли, которую грузовики сыграли в поддержании работы Австралии и открытости цепочек поставок во время COVID.

«Это еще один положительный показатель сильного восстановления Брисбена после COVID со значительным влиянием на экономику из-за прямых расходов тысяч ожидаемых посетителей, а мероприятие обеспечило 70 000 ночей в отелях города.

Г-н О’Киф также отметил экономический эффект мультипликативного эффекта от участия поставщиков и других лиц, работающих на выставке, включая 3000 подрядчиков.

BCEC, официальный партнер #eatqld, продвигающий продукцию Квинсленда и поддерживающий местных производителей, закупил для мероприятия 650 кг говядины из Квинсленда, 1050 кг курицы из Квинсленда и 450 кг местных салатных овощей.

Ожидается, что в течение всего мероприятия Центр обслужит 12 000 порционных блюд и 50 000 наименований еды.

Раздел правил

| Федеральное управление безопасности автотранспортных средств

Раздел § 395.8: Послужной список водителя.

Ниже приведены доступные интерпретации для данного раздела. Чтобы вернуться к списку деталей, используйте ссылку Детали выше. Меню слева содержит полный список разделов, которые имеют интерпретации. Чтобы просмотреть интерпретации для другого раздела, нажмите на пункт меню.

Текст правил раздела можно найти на веб-сайте eCFR. Чтобы просмотреть текст регламента, воспользуйтесь ссылкой ниже. Для получения помощи отправьте электронное письмо по адресу [email protected]
Посмотреть правила для части 395

Вопрос 1: Как должно быть отражено изменение рабочего статуса на короткий период времени в трудовой книжке водителя?

Руководство:

Короткие периоды времени (менее 15 минут) можно определить, проведя линию от соответствующей линии при исполнении служебных обязанностей (без вождения) или за рулем до раздела примечаний и введя количество времени, например «6 минут» и географическое положение смены статуса дежурства.

Вопрос 5: Может ли водитель, привлекаемый в первый раз, вместо подписанного заявления представить отчеты о дежурстве за предыдущие 7 дней?

Инструкции:

Перевозчик может принять верные и точные копии трудовой книжки водителя за предыдущие 7 дней вместо подписанного заявления, требуемого в соответствии с §395. 8(j)(2).

Вопрос 2: Можно ли поставить резиновую печать в трудовой книжке водителя?

Инструктаж:

Нет, в трудовой книжке водителя должна стоять подпись водителя, время которого в ней записано.

Вопрос 6: Как следует фиксировать несколько коротких остановок в одном городе в журнале дежурств?

Руководство:

Все остановки, сделанные в одном городе, деревне или муниципалитете, могут быть засчитаны как одна. В таких случаях сумма всех остановок должна быть показана непрерывной линией как при исполнении служебных обязанностей (без движения). Суммарное время движения между такими остановками должно быть внесено в запись состояния службы сразу же после остановки при исполнении служебных обязанностей (без движения). Вход.Название города, поселка, деревни или муниципалитета, за которым следует аббревиатура штата, в котором имели место все остановки, должно быть указано в разделе «Примечания» служебной записи.

Вопрос 3: Если водительская книжка о служебном положении не подписана, могут ли быть применены меры принудительного характера по служебной книжке текущего дня, если она содержит недостоверную информацию?

Инструкции:

К водителю могут быть применены меры принудительного характера, даже если запись не подписана.Правила требуют, чтобы водитель сохранял актуальную запись о статусе дежурства на момент последнего изменения статуса дежурства (независимо от того, была ли запись подписана). Кроме того, в §395.8(e) говорится, что предоставление ложных сообщений влечет за собой судебное преследование водителя и/или перевозчика.

Вопрос 4: Должны ли водители, чередующие междугороднюю и внутриштатную торговлю, фиксировать время вождения внутри штата в своих служебных записях?

Руководство:

Да, для учета всего рабочего времени за предыдущие 7 или 8 дней, предшествующих межштатной поездке.

Вопрос 7: Приемлема ли канадская двуязычная или любая другая форма записи о служебном статусе в США?

Руководство:

Да, при условии, что формат сетки и требуемая конкретная информация включены.

Вопрос 8: Может ли автоперевозчик вернуть водителю заполненную трудовую книжку для исправления неточных или неполных записей?

Инструкции:

Да, хотя правила не требуют от водителя предоставления «исправленных» записей о статусе службы.Водитель может в любое время предоставить автоперевозчику исправленные записи о служебном статусе. Перевозчику рекомендуется пометить второе представление как «ИСПРАВЛЕННАЯ КОПИЯ» и прикрепить его к исходному представлению в течение требуемого периода хранения.

Вопрос 9: Можно ли представить дубликат служебной книжки, если оригинал был изъят судебным приставом-исполнителем?

Инструкции:

Водитель должен подготовить второй оригинал записи о служебном статусе, чтобы заменить любую страницу, взятую сотрудником правоохранительных органов. Водителю следует обратить внимание на то, что первый оригинал был взят сотрудником правоохранительных органов, и на обстоятельства, при которых он был взят.

Вопрос 10: Какое постановление, толкование и/или административное постановление требует от автомобильного перевозчика сохранять подтверждающие документы и что это за документы?

Руководство:

Раздел 395.8(k)(1) требует, чтобы автомобильные перевозчики хранили все сопроводительные документы в своих основных местах деятельности в течение 6 месяцев с даты получения.

Подтверждающие документы представляют собой записи автомобильного перевозчика, которые ведутся в ходе обычной деятельности и используются автомобильным перевозчиком для проверки информации, записанной в трудовой книжке водителя. Примеры: коносаменты, квитанции перевозчика, счета за фрахт, отчеты об отправке, записи об электронной мобильной связи/отслеживании, квитанции о проходах, квитанции о взвешивании/весе, квитанции о топливе, ведомости о счетах за топливо, квитанции о взимании дорожных сборов, квитанции об оплате дорожных сборов, квитанции о порте въезда. , кассовые авансовые квитанции, квитанции о доставке, квитанции о доставке, отчеты об обмене и инспекции, отчеты об оплате арендодателем, отчеты о превышении / недостатке и повреждениях, отчеты о сельскохозяйственной инспекции, отчеты об осмотре водителя и транспортного средства, отчеты о сбоях, отчеты о телефонных счетах, квитанции по кредитным картам, пересечение границы отчеты, таможенные декларации, дорожные квитанции, а также разрешения на превышение веса/негабарита и дорожные цитаты.К подтверждающим документам могут относиться и другие документы, которые хранятся у автотранспортного перевозчика и могут быть использованы для проверки сведений о трудовой книжке водителя. Если эти записи хранятся в местах, отличных от основного места деятельности, но не используются автомобильным перевозчиком для целей проверки, они должны быть направлены в основное место деятельности по запросу уполномоченного представителя Федеральной дорожной администрации (FHWA). ) или государственным должностным лицом в течение 2 рабочих дней.

[75 ФР 32984, 10 июня 2010 г.]

Вопрос 11: Должен ли водитель, работающий на автомобильном перевозчике время от времени и регулярно нанятый на работу в организации, не являющейся автомобильным перевозчиком, представлять либо записи о статусе работы, либо подписанное заявление о часах работы для всех на -рабочее время как «рабочее время» согласно определению в §395.2?

Руководство:

Да.

Вопрос 12: Может ли водитель использовать «белую» жидкую бумагу для исправления записи о служебном статусе?

Инструкции:

Любой метод исправления будет приемлемым, если он не отменяет обязанности водителя удостоверить своей подписью, что все записи были сделаны водителем и являются верными и правильными.

Вопрос 13: Должны ли водители проводить непрерывные линии между нерабочими, спальными местами, линиями вождения и дежурными (без вождения) линиями в записи рабочего статуса при изменении своего рабочего статуса?

Руководство:

Нет. В соответствии с §395.8(h) Федеральные правила безопасности автомобильных перевозчиков (FMCSR) требуют, чтобы непрерывные линии были проведены между соответствующими маркерами времени в каждой строке статуса работы, но они не требуют, чтобы непрерывные линии были рисуется между соответствующими линиями статуса служебных обязанностей, когда водители меняют свой служебный статус.

Вопрос 14: Какие документы удовлетворяют требованию об указании номера товаросопроводительного документа в служебной записи, как указано в §395.8(d)(11)?

Инструкции:

Ниже приведены некоторые из документов, приемлемых для выполнения требования: отгрузочные манифесты, счета-фактуры/грузовые накладные, отчеты о поездках, чартерные заказы, специальные номера заказов, автобусные счета или любой другой документ, который идентифицирует конкретное движение пассажиров или груза.

В случае нескольких отгрузок один документ удовлетворит требованию. Если водитель направляется в рейс, который впоследствии завершается, а затем в этот же календарный день направляется в другой рейс, в графе примечания в карточке дежурства должны быть указаны два номера товаросопроводительных документов или два грузоотправителя и товара.

Вопрос 15: Если водитель из другой страны работает в США только один день в неделю, должен ли он каждый день вести учет рабочего статуса?

Руководство:

Иностранный водитель, находясь в США.С., должен предоставить текущую запись о статусе дежурства и достаточную документацию, подтверждающую его дежурство за предыдущие 6 дней.

Вопрос 16: Должны ли водители указывать общее время своего дежурства за предыдущие 7–8 дней (если применимо) в послужном списке водителя?

Руководство:

Вопрос 17: Можно ли использовать военное время в графической части трудовой книжки водителя?

Руководство:

Да. Ссылки на 9:00 утра, 15:00 и т. д. в §395.8(d)(6) являются только примерами. Военное время также приемлемо.

Вопрос 18: Раздел 395.8(d)(4) требует, чтобы название автомобильного перевозчика было указано в послужном списке водителя. Если компания владеет более чем одним автомобильным перевозчиком, подпадающим под действие Федеральных правил безопасности автомобильных перевозчиков (FMCSR), может ли компания использовать журналы, в которых перечислены имена всех таких работодателей, и требовать от водителя указать перевозчика, для которого он или она ездит?

Руководство:

Да, при соблюдении трех условий.Во-первых, водитель должен идентифицировать своего работодателя-автоперевозчика способом, который будет виден на ксерокопии журнала. Допустима темная галочка рядом с названием перевозчика. Однако цветное выделение имени было бы неприемлемо, так как эти цвета часто прозрачны для копировальных аппаратов.

Во-вторых, водитель может отметить фамилию работодателя автоперевозчика только в том случае, если он или она работает на одного перевозчика в течение 24-часового периода, указанного в журнале.

В-третьих, если материнская компания использует многодневные журналы (форма 139 или 139A), в журнале за каждый день должны быть перечислены все работодатели автомобильных перевозчиков, а водитель должен указывать своего перевозчика каждый день.

Вопрос 19: Нормативное руководство, выпущенное Управлением автомобильных перевозчиков, гласит, что учетная запись о служебном статусе водителя (RODS) может использоваться в качестве записи времени в радиусе 100 миль «при условии, что форма содержит обязательную информацию». Является ли эта «обязательная информация» необходимой для обычных RODS в соответствии с разделом 395.8(d) или для исключения в радиусе 100 миль в соответствии с разделом 395.1(e)(5)?

Руководство:

Упомянутая «обязательная информация» — это записи времени, указанные в §395.1(e)(5), который должен показывать: (1) время, когда водитель ежедневно прибывает на дежурство; (2) общее количество часов дежурства водителя каждый день; (3) время освобождения водителя от дежурства каждый день; и (4) общее время за предыдущие 7 дней в соответствии с §395. 8(j)(2) для водителей, используемых впервые или с перерывами.

 

Использование RODS в соответствии с §395.1(e)(5) не запрещено, если RODS содержит идентификатор водителя, дату, время начала работы водителя, время окончания работы водителем и общее часов дежурства.

Вопрос 20: Если водитель не соблюдает положения об освобождении от ограничения радиуса действия в 100 миль (раздел 395.1(e)), должен ли водитель иметь копии своих трудовых книжек за предыдущие семь дней? Должен ли водитель составлять ежедневные записи о дежурстве в течение следующих семи дней?

Руководство:

Водитель должен иметь при себе только служебную книжку за тот день, когда он/она не имеет права на освобождение.Запись о дежурстве должна охватывать весь день, даже если водитель должен задним числом записывать изменения в статусе, которые произошли между временем, когда водитель явился на дежурство, и временем, когда он / она больше не имеет права на 100 миль. освобождение от радиуса. Это единственный способ гарантировать, что водитель не будет претендовать на право управления автомобилем в течение 10 часов после выхода из своего статуса освобождения в дополнение к часам, уже пройденным в соответствии с освобождением от 100 авиамиль.

Вопрос 21: Какова ответственность перевозчика, когда его водители фальсифицируют записи о служебном статусе?

Инструктаж:

Перевозчик несет ответственность как за действия своих водителей по представлению фальшивых документов, так и за свои действия по приему фальшивых документов.Автоперевозчики обязаны требовать от водителей соблюдения Федеральных правил безопасности автомобильных перевозчиков (FMCSR).

Вопрос 22: Если водитель регистрирует свой служебный статус как «вождение», но делает несколько коротких остановок (каждая менее 15 минут) по служебным или нерабочим обязанностям, отмечает вертикальную линию на сетке для каждой остановки , и записывает прошедшее время для каждого в разделе примечаний сетки, будет ли общее время, затраченное на эти действия, не связанные с вождением, учитываться в 10-часовом лимите вождения?

Руководство:

№Время работы без вождения или вне работы не засчитывается в 10-часовой лимит вождения.

Вопрос 23: При изменении рабочего статуса водителя требуется ли в §§395.8(c) или 395.8(h)(5) описание служебной деятельности, не связанной с вождением («заправка топливом», «предрейсовая», «погрузка », «разгрузка» и т. д.) в разделе примечаний в дополнение к названию ближайшего города, поселка или села, за которым следует аббревиатура государства?

Руководство:

№Многие автоперевозчики требуют, чтобы водители указывали работу, выполняемую во время смены статуса работы. Часть 395 не требует и не запрещает такую ​​практику.

Вопрос 24: Когда водитель должен поставить подпись/заверить трудовую книжку водителя?

Инструкции:

Как правило, водитель должен расписаться в журнале дежурств сразу после внесения всех необходимых записей в течение 24-часового периода.Однако, если водитель находится за рулем в конце 24-часового периода, он должен расписаться на следующей остановке. Водитель также может подписать запись о служебном статусе после ухода с работы, если он / она рассчитывает не работать до конца 24-часового периода.

Вопрос 25: Должен ли водитель (американский или иностранный) вести запись о служебном статусе (журнал) в иностранном государстве перед въездом в США?

Руководство:

№Федеральное управление автомобильных дорог FHWA не требует от водителей подготовки записей о служебном статусе во время работы за пределами юрисдикции Соединенных Штатов. Тем не менее, любому водителю (американскому или иностранному) может быть выгодно подготовить записи о служебном статусе для краткосрочных поездок за границу. При въезде в США каждый водитель должен: (a) иметь при себе справку о статусе работы, действующую на день экзамена, с указанием общего количества часов, отработанных за предыдущие семь дней подряд, включая время, проведенное за пределами США.С.; или (b) Продемонстрировать, что он/она работает в качестве «водителя с радиусом действия 100 воздушных миль (161 воздушный километр)» в соответствии с §395. 1(e).

Вопрос 26: При каких обстоятельствах водитель может использовать коммерческий автомобиль (CMV) в качестве личного транспортного средства?

Инструктаж:

Водитель может учитывать время эксплуатации CMV для личного транспорта (т. е. для личного пользования или по причинам) как нерабочее только тогда, когда водитель освобожден от работы и вся ответственность за выполнение работы осуществляется автотранспортным предприятием.CMV может использоваться для личных перевозок, даже если он загружен, поскольку в это время груз перевозится не в коммерческих интересах перевозчика. Личное транспортное средство не снижает ответственности водителя или перевозчика за безопасное управление CMV. Автомобильные перевозчики могут устанавливать ограничения на личные перевозки либо в рамках настоящего руководства, либо более ограничительные, чем это, например, запрет на использование CMV для личных целей, наложение ограничения расстояния на личные перевозки или запрет на личные перевозки, когда CMV загружен. .

(a) Примеры надлежащего использования CMV в нерабочее время для личных перевозок включают, но не ограничиваются:

  1. Время, затраченное на дорогу от места проживания водителя в пути (например, мотеля или стоянки грузовиков) в рестораны и развлекательные заведения.
  2. Перемещение между терминалом водителя и его или ее местом жительства, между стоянкой для трейлеров и местом жительства водителя, а также между рабочими местами и его или ее местом жительства. В этих сценариях расстояние до работы в сочетании со временем освобождения от работы и начала работы должно давать водителю достаточно времени для получения необходимого восстановительного отдыха, чтобы гарантировать, что водитель не утомлен.
  3. Время, затраченное на поездку в близлежащее разумное безопасное место для необходимого отдыха после погрузки или разгрузки. Время вождения на личном транспортном средстве должно давать водителю достаточно времени для отдыха в соответствии с минимальными периодами отдыха в соответствии с 49 CFR 395. 3(a)(1) (автотранспортные средства) или 395.5(a) (пассажирские перевозки). транспортных средств) перед возвращением к служебному вождению, и место отдыха должно быть первым разумно доступным таким местом.
  4. Перемещение CMV по требованию сотрудника службы безопасности в нерабочее время водителя.
  5. Время, затраченное на поездку в автобусе без пассажиров до места проживания в пути (например, мотеля или стоянки для грузовиков) или до ресторанов и развлекательных заведений и обратно до места проживания. В этом случае водитель микроавтобуса может потребовать личное транспортное средство, если водитель не при исполнении служебных обязанностей. Другие водители не при исполнении служебных обязанностей могут находиться на борту транспортного средства и не считаются пассажирами.
  6. Время, потраченное на перевозку личного имущества в свободное от работы время.
  7. Разрешенное использование CMV для поездки домой после работы вне офиса.

(b) Примеры использования CMV, которые не могут быть квалифицированы как личное транспортное средство, включают, но не ограничиваются следующим:

  1. Перемещение CMV для повышения эксплуатационной готовности двигателя перевозчик. Например, обход доступных мест отдыха, чтобы приблизиться к следующему пункту погрузки или разгрузки или другому запланированному пункту назначения автотранспорта.
  2. После доставки буксируемой единицы, которая больше не соответствует определению CMV, водитель возвращается в пункт отправления по указанию автоперевозчика, чтобы забрать другую буксируемую единицу.
  3. Продолжение поездки CMV в междуштатной торговле для достижения служебной цели, в том числе бобтейлинг или работа с пустым прицепом для получения другого груза или перемещения CMV (тягача или прицепа) по указанию автотранспортного перевозчика.
  4. Время, затраченное на вождение пассажира, перевозящего CMV, когда пассажиры находятся на борту. Водители не при исполнении служебных обязанностей не считаются пассажирами при поездках в общий пункт назначения по своему выбору в рамках настоящего руководства.
  5. Время, потраченное на транспортировку CMV на объект для проведения технического обслуживания автомобиля.
  6. После увольнения с работы за превышение максимальных сроков, разрешенных в соответствии с частью 395, время, затраченное на поездку в место для необходимого отдыха, если иное не указано сотрудником правоохранительных органов на месте происшествия.
  7. Время, затраченное на дорогу до терминала автомобильного перевозчика после погрузки или разгрузки у отправителя или получателя.
  8. Время, затраченное на управление автобусом, когда багаж уложен, пассажиры высадились и водитель получил указание доставить багаж.

Вопрос 27: [УДАЛЕН И ЗАРЕЗЕРВИРОВАН] [79 ФР 39343, 10.07.2014]

Руководство:

Вопрос 28: Может ли водитель использовать компьютер, планшет или смартфон (не являющийся автоматическим бортовым записывающим устройством) для создания, электронной подписи и хранения протокола дежурства (RODS)?

Руководство:

Да. Водитель может вручную вносить записи о рабочем статусе в программу для компьютера, планшета или смартфона, которая используется для создания сетки графика и записей для регистрации рабочего статуса (RODS) или бортового журнала, при условии, что электронный дисплей (при наличии) ), а вывод включает минимальную информацию, требуемую §395. 8 и оформлен в соответствии с этим разделом. Водитель должен подписывать RODS (вручную или в электронном виде) в конце каждого 24-часового периода, чтобы удостовериться, что все необходимые записи верны и правильны.

  1.  Если электронные подписи не используются:
  • Водитель должен ежедневно распечатывать и подписывать RODS вручную.
  • Водитель должен иметь при себе распечатанные и подписанные RODS за предыдущие семь последовательных дней (если требуется в эти дни).
  • Водителю должна быть предоставлена ​​возможность распечатать и вручную подписать СТЕРЖНИ текущего дня во время осмотра.
  1. Если RODS были подписаны электронной подписью:
  • Во время проверки записей сотрудником правоохранительных органов водитель может отобразить текущие и предыдущие семь дней RODS официальному лицу на экране устройства.
  • Если сотрудник правоохранительных органов запрашивает распечатанные копии RODS, водителю должна быть предоставлена ​​возможность распечатать RODS за текущий и предыдущие семь дней (если требуется в эти дни) во время проверки.

[79 ФР 39343, 10 июля 2014 г.]

Вопрос 29: Должны ли водители, которые в электронном виде сканируют копию своей первоначальной трудовой книжки (RODS) для последующего представления автомобильному перевозчику, подготовить RODS в двух экземплярах?

Руководство:

Нет. Хотя в 49 CFR 395.8(a)(1) говорится: «Каждый водитель, управляющий коммерческим транспортным средством [в торговле между штатами], должен регистрировать свой служебный статус в двух экземплярах для каждого 24- часовой период», цель требования может быть достигнута путем предоставления в электронном виде отсканированного изображения оригинала рукописного RODS обычному автотранспортному перевозчику в течение 13 дней после заполнения формы, в то время как водитель сохраняет оригинальные записи для текущий день и предыдущие 7 дней подряд.Поскольку существующие правила, касающиеся сохранения записей (49 CFR 390.31), позволяют автомобильным перевозчикам хранить в электронном виде отсканированное изображение исходных рукописных RODS, представленных водителями, и, по сути, утилизировать оригинальные бумажные документы, это не оказывает негативного влияния на соблюдение HOS. правил, а затем никаких компромиссов в применении требований безопасности, позволяя водителю представить отсканированное изображение оригинальных подписанных RODS обычному автомобильному перевозчику в течение 13 дней после завершения записи.Автоперевозчики должны хранить отсканированное изображение подписанных RODS и всех сопроводительных документов для каждого водителя в течение шести месяцев с даты получения (49 CFR 395.8(k)).

[75 ФР 32861, 10 июня 2010 г.]


Электрический пикап Ford F-150 Lightning Предварительный просмотр

Все грузовики Lightning оснащены двойным двигателем и полным приводом. Базовая конфигурация имеет 426 л.с. с 775 фунт-фут. крутящего момента. Литий-ионный аккумулятор стандартной дальности обеспечивает запас хода 230 миль.Это кратно тому, что большинство людей используют в обычный день, хотя это меньше половины диапазона, который мы измерили на 2,7-литровом F-150 с полным баком бензина.

Топовая версия имеет мощность 563 л. с. и такой же крутящий момент. Форд утверждает, что при оснащении аккумулятором увеличенного запаса хода эта версия может разгоняться от 0 до 60 миль в час в среднем 4-секундном диапазоне — намного быстрее, чем предыдущие грузовики Lightning — и имеет запас хода 320 миль, по оценкам Агентства по охране окружающей среды. . Ожидается, что на быстром зарядном устройстве постоянного тока мощностью 150 киловатт F-150 Lightning с увеличенным радиусом действия сможет проехать 54 мили за 10 минут и зарядится с 15 до 80 процентов примерно за 41 минуту.Более обычная 240-вольтовая зарядка займет не менее 10 часов.

Как и у F-150 Hybrid, у Lightning в кровати есть розетки для электроинструментов и туристического снаряжения. Базовая комплектация может обеспечить мощность 2,4 киловатта с возможностью увеличения, в то время как серии Lariat и Platinum стандартно поставляются с общей мощностью 9,6 кВт, разделенной между полкой и кроватью. Это даже больше, чем у системы мощностью 7,2 кВт, доступной на гибриде F-150.

F-150 Lightning представляет систему Ford Intelligent Backup Power, которая позволяет грузовику служить источником энергии, обеспечивающим 9.6 кВт электроэнергии во время отключения. Форд говорит, что, исходя из средней потребляемой домом мощности в 30 киловатт-часов, F-150 Lightning с батареей увеличенного радиуса действия может обеспечить полную мощность домохозяйства на срок до трех дней, а в аварийном режиме — до 10 дней. Ford работает с солнечной компанией Sunrun, чтобы предложить 80-амперную зарядную станцию ​​​​Ford Charge Station Pro и систему домашней интеграции, позволяющую легко заряжать грузовик дома с помощью солнечной энергии. Эта система также обеспечивает автоматическое переключение между питанием дома при отключении электроэнергии и обратно на зарядку при восстановлении подачи электроэнергии.

В то время как оригинальные грузовики Lightning предназначались для использования в качестве уличных машин, Lightning третьего поколения будет только полноприводным. Он использует выбираемую водителем систему режимов для настройки трансмиссии в соответствии с конкретными потребностями, включая «Нормальный», «Спорт», «Внедорожник» и «Буксировка / транспортировка». Кроме того, он может похвастаться грузоподъемностью 2000 фунтов (стандартный диапазон) и мощностью буксировки 10 000 фунтов (расширенный диапазон).

Примечательно, что впервые этот F-150 оснащен независимой задней подвеской, что может улучшить его управляемость и комфорт при езде.

Гарантия на электрическую трансмиссию составляет восемь лет или 100 000 миль пробега.

.

Добавить комментарий

Ваш адрес email не будет опубликован.